DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32847 and AT1G19310

DIOPT Version :9

Sequence 1:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_564078.1 Gene:AT1G19310 / 838513 AraportID:AT1G19310 Length:226 Species:Arabidopsis thaliana


Alignment Length:214 Identity:57/214 - (26%)
Similarity:90/214 - (42%) Gaps:65/214 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DTKDESFYECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSGVDRSKVIPVYAR 73
            :..|.|.:|||||||.||:.:|::|||||||||||:|:........|||||:.::..:::|:|.|
plant    14 NNNDSSNFECNICLDLAQDPIVTLCGHLFCWPCLYKWLHLHSQSKDCPVCKAVIEEDRLVPLYGR 78

  Fly    74 NDKRQEDPRDKT------PPRPTG--------------------------------IWSDYANDL 100
            . |...|||.|:      |.||:|                                ..:.:.|..
plant    79 G-KSSADPRSKSIPGLEVPNRPSGQRPETAQPPDPNHGFAHHHGFGGFMGGFAAPMASARFGNVT 142

  Fly   101 ELGLFSYLLFGLF--------------------FPYGALSSYLDMDEPLNPAADHGIRDGQNETL 145
            ....|..|:..||                    ||:|..:.:......::....|..|.||.:..
plant   143 LSAAFGGLIPSLFNLHFHGFPDAAMYGAAASGGFPHGFSNPFHGGHSHMHSYQRHTGRQGQQDHH 207

  Fly   146 LSKFFLYVAIMLIIYMIVI 164
            |.      .::||::::|:
plant   208 LR------ILLLIVFVVVV 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32847NP_730026.1 PLN03208 4..>91 CDD:178747 40/87 (46%)
RING 17..60 CDD:238093 26/42 (62%)
AT1G19310NP_564078.1 rad18 21..>112 CDD:273165 39/91 (43%)
RING-HC_AtRMA_like 21..65 CDD:319659 26/43 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 78 1.000 Domainoid score I3052
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I2031
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 1 1.000 - - mtm1175
orthoMCL 1 0.900 - - OOG6_102074
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X682
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.