DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32847 and RMA3

DIOPT Version :9

Sequence 1:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_194477.2 Gene:RMA3 / 828856 AraportID:AT4G27470 Length:243 Species:Arabidopsis thaliana


Alignment Length:150 Identity:45/150 - (30%)
Similarity:66/150 - (44%) Gaps:48/150 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YECNICLDTAQNAVVSMCGHLFCWPCLYQWI------LTKPDH-TVCPVCKSGVDRSKVIPVYAR 73
            ::||||||||.:.||::|||||||||:|:|:      ::...| ..||||||.:..:.::|:|.|
plant    42 FDCNICLDTAHDPVVTLCGHLFCWPCIYKWLHVQLSSVSVDQHQNNCPVCKSNITITSLVPLYGR 106

  Fly    74 ---------NDKRQEDPRDKTPPRPTGIWSDYANDLELGLFSYLLFGLFFPYGALSSYLDMDEPL 129
                     ..|:|:......|.||..                         .||.:.:.....|
plant   107 GMSSPSSTFGSKKQDALSTDIPRRPAP-------------------------SALRNPITSASSL 146

  Fly   130 NPAADHGIRDGQNETLLSKF 149
            ||:..|       :||...|
plant   147 NPSLQH-------QTLSPSF 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32847NP_730026.1 PLN03208 4..>91 CDD:178747 36/90 (40%)
RING 17..60 CDD:238093 26/49 (53%)
RMA3NP_194477.2 PLN03208 37..228 CDD:178747 44/149 (30%)
RING 43..95 CDD:238093 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X682
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.