DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32847 and AT3G07200

DIOPT Version :9

Sequence 1:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001078119.1 Gene:AT3G07200 / 819908 AraportID:AT3G07200 Length:182 Species:Arabidopsis thaliana


Alignment Length:60 Identity:17/60 - (28%)
Similarity:28/60 - (46%) Gaps:3/60 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DESFYECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSGVDRSKVIPVY 71
            :|..:.|.|||......|.:.|||:||..|:...:..:   ..||.|:..:....:|.|:
plant   121 EEPKFSCPICLCPFTQEVSTKCGHIFCKKCIKNALSLQ---AKCPTCRKKITVKDLIRVF 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32847NP_730026.1 PLN03208 4..>91 CDD:178747 17/60 (28%)
RING 17..60 CDD:238093 14/42 (33%)
AT3G07200NP_001078119.1 RING 127..168 CDD:238093 14/43 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.