powered by:
Protein Alignment CG32847 and AT3G07200
DIOPT Version :9
Sequence 1: | NP_730026.1 |
Gene: | CG32847 / 318245 |
FlyBaseID: | FBgn0052847 |
Length: | 164 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001078119.1 |
Gene: | AT3G07200 / 819908 |
AraportID: | AT3G07200 |
Length: | 182 |
Species: | Arabidopsis thaliana |
Alignment Length: | 60 |
Identity: | 17/60 - (28%) |
Similarity: | 28/60 - (46%) |
Gaps: | 3/60 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 DESFYECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSGVDRSKVIPVY 71
:|..:.|.|||......|.:.|||:||..|:...:..: ..||.|:..:....:|.|:
plant 121 EEPKFSCPICLCPFTQEVSTKCGHIFCKKCIKNALSLQ---AKCPTCRKKITVKDLIRVF 177
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.