DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32847 and AT2G44410

DIOPT Version :9

Sequence 1:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_181969.2 Gene:AT2G44410 / 819048 AraportID:AT2G44410 Length:413 Species:Arabidopsis thaliana


Alignment Length:81 Identity:34/81 - (41%)
Similarity:47/81 - (58%) Gaps:6/81 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FYECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSGVDRSKVIPVYARND---- 75
            |::|||||:.|::.:::.|||||||.|.||..|...:...||||...|..::|||:|...|    
plant   122 FFDCNICLEKAEDPILTCCGHLFCWGCFYQLPLIYLNIKECPVCDGEVTDAEVIPIYGNGDDCDG 186

  Fly    76 --KRQEDPRDKTPPRP 89
              .:.||.....||||
plant   187 TKPKLEDCGISLPPRP 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32847NP_730026.1 PLN03208 4..>91 CDD:178747 34/81 (42%)
RING 17..60 CDD:238093 21/42 (50%)
AT2G44410NP_181969.2 PEX10 <71..175 CDD:227861 23/52 (44%)
RING_Ubox 123..165 CDD:418438 19/41 (46%)
RING-HC finger (C3HC4-type) 125..165 CDD:319361 19/39 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.