powered by:
Protein Alignment CG32847 and PEX10
DIOPT Version :9
Sequence 1: | NP_730026.1 |
Gene: | CG32847 / 318245 |
FlyBaseID: | FBgn0052847 |
Length: | 164 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_565621.1 |
Gene: | PEX10 / 817175 |
AraportID: | AT2G26350 |
Length: | 381 |
Species: | Arabidopsis thaliana |
Alignment Length: | 62 |
Identity: | 21/62 - (33%) |
Similarity: | 36/62 - (58%) |
Gaps: | 3/62 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 TKDESFYECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSGVDRSKVIPVY 71
|..|:..:|.:||.|.|:...:.|||:|||.|:.:|...|.: ||:|::....|.::.:|
plant 319 TSTEAVGKCTLCLSTRQHPTATPCGHVFCWSCIMEWCNEKQE---CPLCRTPNTHSSLVCLY 377
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5574 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.