DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32847 and AT2G23780

DIOPT Version :9

Sequence 1:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001318276.1 Gene:AT2G23780 / 816910 AraportID:AT2G23780 Length:227 Species:Arabidopsis thaliana


Alignment Length:213 Identity:65/213 - (30%)
Similarity:89/213 - (41%) Gaps:63/213 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DTKDE-SFYECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSGVDRSKVIPVYA 72
            ||.|: ..:|||||.:.||:.:|::|||||||||||:|:........|||||:.|...|::|:|.
plant    18 DTNDQGGDFECNICFELAQDPIVTLCGHLFCWPCLYRWLHHHSHSQECPVCKAVVQDDKLVPLYG 82

  Fly    73 RNDKRQEDPRDK------TPPRPTGIWSDYA----------NDLELGL----------------- 104
            |. |.|.|||.|      .|.||||...:.|          |....|:                 
plant    83 RG-KNQTDPRSKRYPGLRIPNRPTGQRPETAAPPPQPEAASNFFNYGIGLMGGIMPMMATTRFGN 146

  Fly   105 ----FSYLLFGLF------------------FPYGALSSYLDMDEPL---NPAADHGIRDGQNET 144
                |..||..||                  :|||...:......|.   .|.|..|   .|::.
plant   147 FSMGFGGLLPSLFNFQFHGFHDATLYGSTPGYPYGGYHNGFRGVPPRGQERPMARGG---NQSDA 208

  Fly   145 LLSKFFLYVAIMLIIYMI 162
            .|.....:|.|.::|::|
plant   209 FLKNILFFVGICVVIFLI 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32847NP_730026.1 PLN03208 4..>91 CDD:178747 42/88 (48%)
RING 17..60 CDD:238093 24/42 (57%)
AT2G23780NP_001318276.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 78 1.000 Domainoid score I3052
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I2031
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 1 1.000 - - mtm1175
orthoMCL 1 0.900 - - OOG6_102074
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X682
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.