DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32847 and Pex10

DIOPT Version :9

Sequence 1:	NP_730026.1	Gene:	CG32847 / 318245	FlyBaseID:	FBgn0052847	Length:	164	Species:	Drosophila melanogaster
Sequence 2:	NP_001102875.1	Gene:	Pex10 / 680424	RGDID:	1591776	Length:	324	Species:	Rattus norvegicus

Alignment Length:	57	Identity:	22/57 - (38%)
Similarity:	34/57 - (59%)	Gaps:	5/57 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly    18 CNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSGVDRSKVIPVYARN 74
            |.:||:..:::..:.|||||||.|:.:|..||   |.||:|:......|:  ||.|:
  Rat   271 CTLCLEERRHSTATPCGHLFCWECITEWCNTK---TECPLCREKFPPQKL--VYLRH 322

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32847	NP_730026.1	PLN03208	4..>91	CDD:178747	22/57 (39%)
CG32847	NP_730026.1	RING	17..60	CDD:238093	18/41 (44%)
Pex10	NP_001102875.1	Pex2_Pex12	16..216	CDD:282595
Pex10	NP_001102875.1	zf-RING_2	271..309	CDD:290367	17/40 (43%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5574
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	2	1.900