DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32847 and RNF5

DIOPT Version :9

Sequence 1:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_008844.1 Gene:RNF5 / 6048 HGNCID:10068 Length:180 Species:Homo sapiens


Alignment Length:162 Identity:65/162 - (40%)
Similarity:96/162 - (59%) Gaps:19/162 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSGVDRSKVIPVYARNDKRQED 80
            :||||||:||:.||||:||||:|||||:||:.|:|:...|||||:|:.|.||:|:|.|..::.:|
Human    25 FECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQD 89

  Fly    81 PRDKTPPRPTGI---------WSDYANDLELGLFSYLLFGL-FFPYGALSSYLDMDEPLNPAADH 135
            ||.||||||.|.         :..:.   :.|.| :..||: .||:|..::..:..||.....  
Human    90 PRLKTPPRPQGQRPAPESRGGFQPFG---DTGGF-HFSFGVGAFPFGFFTTVFNAHEPFRRGT-- 148

  Fly   136 GIRDGQNETLLS---KFFLYVAIMLIIYMIVI 164
            |:..||.....|   ..||::||....:::.|
Human   149 GVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32847NP_730026.1 PLN03208 4..>91 CDD:178747 46/74 (62%)
RING 17..60 CDD:238093 29/42 (69%)
RNF5NP_008844.1 PLN03208 21..>116 CDD:178747 47/93 (51%)
RING-HC_RNF5 25..70 CDD:319657 30/44 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..110 12/30 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152549
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102074
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X682
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.