DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32847 and RNF4

DIOPT Version :10

Sequence 1:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_002929.1 Gene:RNF4 / 6047 HGNCID:10067 Length:190 Species:Homo sapiens


Alignment Length:61 Identity:19/61 - (31%)
Similarity:29/61 - (47%) Gaps:10/61 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CNICLD----TAQNA---VVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSGVDRSKVIPVY 71
            |.||:|    ..||.   |.:.|||:||..||..   :..:...||.|:..::..:..|:|
Human   132 CPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRD---SLKNANTCPTCRKKINHKRYHPIY 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32847NP_730026.1 RING_Ubox 16..71 CDD:473075 18/59 (31%)
RNF4NP_002929.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Required for ubiquitination activity. /evidence=ECO:0000250|UniProtKB:Q9QZS2 1..16
Mediates interaction with TRPS1. /evidence=ECO:0000250|UniProtKB:Q9QZS2 4..61
SUMO interaction motif 1. /evidence=ECO:0000269|PubMed:18408734 36..39
SUMO interaction motif 2. /evidence=ECO:0000269|PubMed:18408734 46..49
SUMO interaction motif 3. /evidence=ECO:0000269|PubMed:18408734 57..59
SUMO interaction motif 4. /evidence=ECO:0000269|PubMed:18408734 67..70
RING-HC_RNF4 127..183 CDD:438195 17/53 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.