DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32847 and rnf5

DIOPT Version :9

Sequence 1:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001017071.1 Gene:rnf5 / 549825 XenbaseID:XB-GENE-974969 Length:168 Species:Xenopus tropicalis


Alignment Length:157 Identity:68/157 - (43%)
Similarity:99/157 - (63%) Gaps:8/157 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSGVDRSKVIPVYARNDKRQED 80
            |||||||:||:..|||:||||:|||||:||:.|:||...|||||:|:.|.||||:|.|.|..|:|
 Frog    12 YECNICLETAREPVVSVCGHLYCWPCLHQWLETRPDRQECPVCKAGISREKVIPIYGRGDSNQKD 76

  Fly    81 PRDKTPPRPTGIWSDYANDLELGL--FS----YLLFGL-FFPYGALSSYLDMDEPLN-PAADHGI 137
            ||.||||||.|...:..|....|:  |:    ::.||: .||:|..::..:.::..: |.||.|:
 Frog    77 PRLKTPPRPQGQRPEPENRAGGGVPGFTDTGFHMSFGIGAFPFGFFTTVFNTNDLHSAPRADTGL 141

  Fly   138 RDGQNETLLSKFFLYVAIMLIIYMIVI 164
            ...:...|....||.:|....:::|.:
 Frog   142 PQSRFFGLPDSLFLIIAAFFFLWLISV 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32847NP_730026.1 PLN03208 4..>91 CDD:178747 50/74 (68%)
RING 17..60 CDD:238093 29/42 (69%)
rnf5NP_001017071.1 RING-HC_RNF5 12..57 CDD:319657 31/44 (70%)
RING-HC finger (C3HC4-type) 14..54 CDD:319657 26/39 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 90 1.000 Domainoid score I7661
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X682
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.