powered by:
Protein Alignment CG32847 and pex10
DIOPT Version :9
Sequence 1: | NP_730026.1 |
Gene: | CG32847 / 318245 |
FlyBaseID: | FBgn0052847 |
Length: | 164 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001005994.1 |
Gene: | pex10 / 449821 |
ZFINID: | ZDB-GENE-041010-71 |
Length: | 318 |
Species: | Danio rerio |
Alignment Length: | 62 |
Identity: | 25/62 - (40%) |
Similarity: | 34/62 - (54%) |
Gaps: | 11/62 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 CNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSGVDRSKVIP---VYARNDK 76
|.:||:..:|...:.|||||||.|:.:|..||.: ||:| |.|..| ||.|:.|
Zfish 265 CILCLEERRNTTSTPCGHLFCWECITEWCNTKNE---CPLC-----REKFQPHRLVYLRSYK 318
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5574 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.