DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32847 and CG8141

DIOPT Version :9

Sequence 1:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_731776.1 Gene:CG8141 / 41622 FlyBaseID:FBgn0038125 Length:239 Species:Drosophila melanogaster


Alignment Length:153 Identity:43/153 - (28%)
Similarity:68/153 - (44%) Gaps:41/153 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSG-VDRSKVIPVYARN-DKRQ 78
            |.||.|....:..|:::|||||||.||:. .|:......||.|:.. :....::|.:... :.||
  Fly    83 YVCNECNQYVRGGVITICGHLFCWTCLWP-KLSGTAQPRCPCCQRHLLMYEDIMPFHGEGPNARQ 146

  Fly    79 EDPRDKTP------PRPTGIWSDYANDLELGLFSYLLFGLFFPYGALSSYLDMDEPLN--PAADH 135
            ||  :..|      |||||:   |.:|.:            ||     .:..:::|::  ||...
  Fly   147 ED--NNVPAQPGSVPRPTGL---YLSDTD------------FP-----CWFAVNDPVDGCPATFP 189

  Fly   136 GIRDGQNETLLSKFFLYVAIMLI 158
            .||..::        |:.||.||
  Fly   190 DIRRERD--------LHCAIRLI 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32847NP_730026.1 PLN03208 4..>91 CDD:178747 27/82 (33%)
RING 17..60 CDD:238093 17/42 (40%)
CG8141NP_731776.1 zf-C3HC4_2 85..124 CDD:290634 16/39 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12313
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.