DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32847 and Rnf5

DIOPT Version :9

Sequence 1:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001102495.1 Gene:Rnf5 / 407784 RGDID:1588458 Length:180 Species:Rattus norvegicus


Alignment Length:162 Identity:67/162 - (41%)
Similarity:97/162 - (59%) Gaps:19/162 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSGVDRSKVIPVYARNDKRQED 80
            :||||||:||:.||||:||||:|||||:||:.|:||...|||||:|:.|.||:|:|.|..::.:|
  Rat    25 FECNICLETAREAVVSVCGHLYCWPCLHQWLETRPDRQECPVCKAGISREKVVPLYGRGSQKPQD 89

  Fly    81 PRDKTPPRPTGI---------WSDYANDLELGLFSYLLFGL-FFPYGALSSYLDMDEPLNPAADH 135
            ||.||||||.|.         :..:.   :.|.| :..||: .||:|..::..:..||....|  
  Rat    90 PRLKTPPRPQGQRPAPESRGGFQPFG---DAGGF-HFSFGVGAFPFGFFTTVFNAHEPFRRGA-- 148

  Fly   136 GIRDGQNETLLS---KFFLYVAIMLIIYMIVI 164
            |:..||.....|   ..||::||....:::.|
  Rat   149 GVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32847NP_730026.1 PLN03208 4..>91 CDD:178747 47/74 (64%)
RING 17..60 CDD:238093 30/42 (71%)
Rnf5NP_001102495.1 PLN03208 25..>117 CDD:178747 48/94 (51%)
RING-HC_RNF5 25..70 CDD:319657 31/44 (70%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..110 12/30 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346067
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102074
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X682
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.710

Return to query results.
Submit another query.