DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32847 and rnf185

DIOPT Version :9

Sequence 1:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_998202.1 Gene:rnf185 / 406310 ZFINID:ZDB-GENE-040426-1977 Length:194 Species:Danio rerio


Alignment Length:158 Identity:68/158 - (43%)
Similarity:106/158 - (67%) Gaps:7/158 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ESFYECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSGVDRSKVIPVYARNDKR 77
            :|.:||||||||:::||:|:||||||||||:||:.|:|:..||||||:|:.|.||||:|.|....
Zfish    36 DSTFECNICLDTSKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTG 100

  Fly    78 QEDPRDKTPPRPTGIWSDYANDLELGLFSY------LLFGL-FFPYGALSSYLDMDEPLNPAADH 135
            |:|||:||||||.|...:..|......|.:      :.||: .||:|..::..::::...|.|..
Zfish   101 QQDPREKTPPRPQGQRPEPENRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAAP 165

  Fly   136 GIRDGQNETLLSKFFLYVAIMLIIYMIV 163
            |.....:|..||:.||:||::::.::::
Zfish   166 GTPQHTDEQFLSRLFLFVALLIMFWLLI 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32847NP_730026.1 PLN03208 4..>91 CDD:178747 50/77 (65%)
RING 17..60 CDD:238093 30/42 (71%)
rnf185NP_998202.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
Required for ubiquitin ligase activity and protection against ER stress-induced cell death. /evidence=ECO:0000250|UniProtKB:Q96GF1 31..82 30/45 (67%)
RING 40..85 CDD:238093 31/44 (70%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..126 15/33 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587023
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102074
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X682
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.