DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32847 and Rnf185

DIOPT Version :9

Sequence 1:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001019442.1 Gene:Rnf185 / 360967 RGDID:1564777 Length:192 Species:Rattus norvegicus


Alignment Length:158 Identity:69/158 - (43%)
Similarity:106/158 - (67%) Gaps:7/158 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ESFYECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSGVDRSKVIPVYARNDKR 77
            :|.:|||||||||::||:|:||||||||||:||:.|:|:..||||||:|:.|.||||:|.|....
  Rat    34 DSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTG 98

  Fly    78 QEDPRDKTPPRPTGIWSDYANDLELGLFSY------LLFGL-FFPYGALSSYLDMDEPLNPAADH 135
            |:|||:||||||.|...:..|......|.:      :.||: .||:|..::..::::...|.|..
  Rat    99 QQDPREKTPPRPQGQRPEPENRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVP 163

  Fly   136 GIRDGQNETLLSKFFLYVAIMLIIYMIV 163
            |.....:|..||:.||:||::::.::::
  Rat   164 GTPQYVDEQFLSRLFLFVALVIMFWLLI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32847NP_730026.1 PLN03208 4..>91 CDD:178747 51/77 (66%)
RING 17..60 CDD:238093 31/42 (74%)
Rnf185NP_001019442.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Required for ubiquitin ligase activity and protection against ER stress-induced cell death. /evidence=ECO:0000250|UniProtKB:Q96GF1 29..80 31/45 (69%)
RING-HC_RNF185 38..80 CDD:319658 30/41 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..123 15/32 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346066
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102074
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X682
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.710

Return to query results.
Submit another query.