DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32847 and CG32581

DIOPT Version :9

Sequence 1:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001096988.2 Gene:CG32581 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster


Alignment Length:162 Identity:78/162 - (48%)
Similarity:107/162 - (66%) Gaps:11/162 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TKDESFYECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSGVDRSKVIPVYARN 74
            |.|:|.||||||||||::|||||||||||||||:||:||:|:..:|||||:.||:.||||:|.||
  Fly   117 TADDSLYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPLYGRN 181

  Fly    75 DKRQEDPRDKTPPRPTGIWSDYANDLELGL--FSY-----LLFGL-FFPYGALSSYLDMDEPLNP 131
            ...|||||:|.||||.|..::  .|...|.  |.:     :.||: .||:|.::|.|:..||..|
  Fly   182 STHQEDPRNKVPPRPAGQRTE--PDPVPGFPGFGFGDGFHMSFGIGAFPFGFITSRLNFFEPRPP 244

  Fly   132 AADHGIRDGQNETLLSKFFLYVAIMLIIYMIV 163
            |....:.:.: ...|||.|.:..:.:|..::|
  Fly   245 ADIRRLHEDE-PWALSKLFWHFVVFVIYGLLV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32847NP_730026.1 PLN03208 4..>91 CDD:178747 57/80 (71%)
RING 17..60 CDD:238093 33/42 (79%)
CG32581NP_001096988.2 RING 124..169 CDD:238093 34/44 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457063
Domainoid 1 1.000 78 1.000 Domainoid score I3052
eggNOG 1 0.900 - - E1_COG5574
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I2031
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 1 1.000 - - mtm1175
orthoMCL 1 0.900 - - OOG6_102074
Panther 1 1.100 - - P PTHR12313
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X682
1110.800

Return to query results.
Submit another query.