DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32847 and slx8

DIOPT Version :10

Sequence 1:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_595523.1 Gene:slx8 / 2540618 PomBaseID:SPBC3D6.11C Length:269 Species:Schizosaccharomyces pombe


Alignment Length:53 Identity:22/53 - (41%)
Similarity:31/53 - (58%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSGVDRSKVI 68
            |:|.||||:.:|...:.|||:||..|:...:.|......||||:..|..:|||
pombe   204 YKCVICLDSPENLSCTPCGHIFCNFCILSALGTTAATQKCPVCRRKVHPNKVI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32847NP_730026.1 RING_Ubox 16..71 CDD:473075 22/53 (42%)
slx8NP_595523.1 PEX10 1..260 CDD:227861 22/53 (42%)

Return to query results.
Submit another query.