powered by:
Protein Alignment CG32847 and slx8
DIOPT Version :9
Sequence 1: | NP_730026.1 |
Gene: | CG32847 / 318245 |
FlyBaseID: | FBgn0052847 |
Length: | 164 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_595523.1 |
Gene: | slx8 / 2540618 |
PomBaseID: | SPBC3D6.11c |
Length: | 269 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 53 |
Identity: | 22/53 - (41%) |
Similarity: | 31/53 - (58%) |
Gaps: | 0/53 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 YECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSGVDRSKVI 68
|:|.||||:.:|...:.|||:||..|:...:.|......||||:..|..:|||
pombe 204 YKCVICLDSPENLSCTPCGHIFCNFCILSALGTTAATQKCPVCRRKVHPNKVI 256
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5574 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000717 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.