DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32847 and pas4

DIOPT Version :9

Sequence 1:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_595592.1 Gene:pas4 / 2539774 PomBaseID:SPBC17A3.10 Length:306 Species:Schizosaccharomyces pombe


Alignment Length:76 Identity:22/76 - (28%)
Similarity:38/76 - (50%) Gaps:11/76 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSADTFVMDTKD--------ESFYECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPV 57
            :|:.|...|.:|        |...:|::|::.......:.|||:|||.|:..|...|.:   ||:
pombe   231 ISSITDERDLEDKNKLPFIPEGNRKCSLCMEFIHCPAATECGHIFCWSCINGWTSKKSE---CPL 292

  Fly    58 CKSGVDRSKVI 68
            |::....||:|
pombe   293 CRAFSSPSKII 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32847NP_730026.1 PLN03208 4..>91 CDD:178747 21/73 (29%)
RING 17..60 CDD:238093 14/42 (33%)
pas4NP_595592.1 PEX10 1..306 CDD:227861 22/76 (29%)
RING 255..295 CDD:238093 14/42 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X682
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.