DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32847 and Trim26

DIOPT Version :9

Sequence 1:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001020770.2 Gene:Trim26 / 22670 MGIID:1337056 Length:545 Species:Mus musculus


Alignment Length:54 Identity:19/54 - (35%)
Similarity:28/54 - (51%) Gaps:0/54 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSGVDRSKVIPVY 71
            |:||||..::.|...|||:||..|.........:..|||:||....:..:.||:
Mouse    16 CSICLDYLRDPVTIDCGHVFCRSCTSDIRPISGNRPVCPLCKKPFKKENIRPVW 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32847NP_730026.1 PLN03208 4..>91 CDD:178747 19/54 (35%)
RING 17..60 CDD:238093 16/41 (39%)
Trim26NP_001020770.2 RING-HC_TRIM26_C-IV 13..57 CDD:319512 15/40 (38%)
RING-HC finger (C3HC4-type) 16..56 CDD:319512 15/39 (38%)
Bbox2_TRIM10-like 100..138 CDD:380823
SPRY_PRY_TRIM15 320..544 CDD:293998
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5784
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.