DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32847 and sli-1

DIOPT Version :9

Sequence 1:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_508145.2 Gene:sli-1 / 180419 WormBaseID:WBGene00004829 Length:582 Species:Caenorhabditis elegans


Alignment Length:161 Identity:42/161 - (26%)
Similarity:56/161 - (34%) Gaps:38/161 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SFYECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCK---SG-----VDRSKVIPV 70
            :|..|.||.|..:|..:..||||.|..||..|..:......||.|:   .|     :||.|..||
 Worm   386 TFELCKICDDNEKNIKIEPCGHLLCAKCLANWQDSDGGGNTCPFCRYEIKGTNRVIIDRFKPTPV 450

  Fly    71 YARNDKRQEDPRDK-------TPPRPTGIWSDYANDLELGLFSYLLFGLFFPYGALSSYLDMDE- 127
            .....|.......|       .|||      .|.:.....|.          :.|.:|...:|| 
 Worm   451 EIEKAKNVAAAEKKLISLVPDVPPR------TYVSQCSQSLL----------HDASNSIPSVDEL 499

  Fly   128 -----PLNPAADHGIRDGQNETLLSKFFLYV 153
                 ||.|.| .|..|..|.:..|..::.:
 Worm   500 PLVPPPLPPKA-LGTLDTLNSSQTSSSYVNI 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32847NP_730026.1 PLN03208 4..>91 CDD:178747 28/91 (31%)
RING 17..60 CDD:238093 16/45 (36%)
sli-1NP_508145.2 Cbl_N 67..183 CDD:280432
Cbl_N2 187..271 CDD:280857
SH2_Cbl-b_TKB 265..361 CDD:198176
RING 390..434 CDD:238093 16/43 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.