DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32847 and LOC108645161

DIOPT Version :9

Sequence 1:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster
Sequence 2:XP_017945482.2 Gene:LOC108645161 / 108645161 -ID:- Length:589 Species:Xenopus tropicalis


Alignment Length:51 Identity:17/51 - (33%)
Similarity:25/51 - (49%) Gaps:5/51 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CNICLDTAQNAVVSMCGHLFCWPCLYQ-WILTK---PDHTVCPVCKSGVDR 64
            |:||.:...:.|...|||.||..|:.. |...:   .|:: ||:|...|.|
 Frog    10 CSICRNVYTDPVTLTCGHNFCRGCMTNTWNSRERLGEDYS-CPLCCKSVMR 59

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32847NP_730026.1 PLN03208 4..>91 CDD:178747 17/51 (33%)
RING 17..60 CDD:238093 15/45 (33%)
LOC108645161XP_017945482.2 RING_Ubox 8..53 CDD:418438 14/43 (33%)
Bbox_SF 87..127 CDD:412124
Bbox2_TRIM16-like 134..180 CDD:380827
BBC 180..294 CDD:128778
SPRY_PRY_C-I_2 412..587 CDD:293949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.