powered by:
Protein Alignment CG32847 and LOC108645161
DIOPT Version :9
Sequence 1: | NP_730026.1 |
Gene: | CG32847 / 318245 |
FlyBaseID: | FBgn0052847 |
Length: | 164 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017945482.2 |
Gene: | LOC108645161 / 108645161 |
-ID: | - |
Length: | 589 |
Species: | Xenopus tropicalis |
Alignment Length: | 51 |
Identity: | 17/51 - (33%) |
Similarity: | 25/51 - (49%) |
Gaps: | 5/51 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 CNICLDTAQNAVVSMCGHLFCWPCLYQ-WILTK---PDHTVCPVCKSGVDR 64
|:||.:...:.|...|||.||..|:.. |...: .|:: ||:|...|.|
Frog 10 CSICRNVYTDPVTLTCGHNFCRGCMTNTWNSRERLGEDYS-CPLCCKSVMR 59
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1510545at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.