DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32847 and rnf5

DIOPT Version :9

Sequence 1:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster
Sequence 2:XP_003200552.1 Gene:rnf5 / 100537822 ZFINID:ZDB-GENE-100805-3 Length:205 Species:Danio rerio


Alignment Length:169 Identity:69/169 - (40%)
Similarity:101/169 - (59%) Gaps:18/169 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KDESFYECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSGVDRSKVIPVYARND 75
            ::.:.:|||||||||::||:|:||||||||||:||:.|:|....|||||:|:.|.||||:|.|..
Zfish    40 RERATFECNICLDTARDAVISLCGHLFCWPCLHQWLETRPSRQQCPVCKAGISRDKVIPLYGRGS 104

  Fly    76 KRQEDPRDKTPPRPTGIWSDYANDLELGLFS-------YLLFGL-FFPYGALSSYLDMDEPLNPA 132
            ..|||||.||||||.|..|:..:   .|.|.       ::.||: .||:|..::..:.:.|.:.|
Zfish   105 SSQEDPRLKTPPRPQGQRSEPES---RGPFQGFGDTGFHMSFGIGAFPFGFFTTVFNTNNPFHRA 166

  Fly   133 -ADHGIRDGQNETL------LSKFFLYVAIMLIIYMIVI 164
             |.:|.....||..      ....||::||....:::.:
Zfish   167 DAHYGADQQANENANNGNNWQDSLFLFLAIFFFFWILSV 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32847NP_730026.1 PLN03208 4..>91 CDD:178747 50/79 (63%)
RING 17..60 CDD:238093 30/42 (71%)
rnf5XP_003200552.1 PLN03208 45..>141 CDD:178747 54/98 (55%)
RING 46..91 CDD:238093 31/44 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587024
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102074
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X682
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.