DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32847 and btr24

DIOPT Version :9

Sequence 1:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster
Sequence 2:XP_017207881.1 Gene:btr24 / 100000030 ZFINID:ZDB-GENE-070705-376 Length:555 Species:Danio rerio


Alignment Length:103 Identity:25/103 - (24%)
Similarity:42/103 - (40%) Gaps:7/103 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSADTFVMDTKDESFYECNICLDTAQNAVVSMCGHLFCWPCLYQ-WILTKPDHTVCPVCKSGVDR 64
            ||:.:|.:..:    .:|:||||...:.|.:.|||.||..||.. |  .......||.|.....:
Zfish    26 MSSTSFPLSEE----LQCSICLDVFTDPVSTPCGHNFCKSCLNTCW--NNSQTCSCPYCNETFTQ 84

  Fly    65 SKVIPVYARNDKRQEDPRDKTPPRPTGIWSDYANDLEL 102
            ...:.:.....:..|..::|.|.:...|..:.....:|
Zfish    85 RPDLKINTTLREISEHYKEKNPAKKPRIMCEICEGRKL 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32847NP_730026.1 PLN03208 4..>91 CDD:178747 21/87 (24%)
RING 17..60 CDD:238093 17/43 (40%)
btr24XP_017207881.1 RING 38..82 CDD:238093 17/45 (38%)
zf-B_box 165..201 CDD:279037
SPRY_PRY_C-I_1 379..553 CDD:293968
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.