DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32845 and ESS1

DIOPT Version :9

Sequence 1:NP_728511.1 Gene:CG32845 / 318243 FlyBaseID:FBgn0052845 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_012551.2 Gene:ESS1 / 853475 SGDID:S000003778 Length:170 Species:Saccharomyces cerevisiae


Alignment Length:168 Identity:51/168 - (30%)
Similarity:83/168 - (49%) Gaps:15/168 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LPFGWEERIAHSTKECYFYDTITRKVHFTLPPSHHREKDRNAWGAILGDYSDFNDQLRCRHILVK 137
            ||..|..|.:.|.|..||::..|:...:..|...::::       :.....|...::||.|||:|
Yeast    11 LPTPWTVRYSKSKKREYFFNPETKHSQWEEPEGTNKDQ-------LHKHLRDHPVRVRCLHILIK 68

  Fly   138 HSESDRCSSYRERMVRRTKQEALNKIMHARDLI-----QSGKFEFAELANMISDCCSARHGGDLG 197
            |.:|.|.:|:|...:..:||:|.:::   :.||     .|....|..||...|||.|.:.|||||
Yeast    69 HKDSRRPASHRSENITISKQDATDEL---KTLITRLDDDSKTNSFEALAKERSDCSSYKRGGDLG 130

  Fly   198 PLSLTQTPFVFERNILLLKDGELSEIFQTKAGYHILLR 235
            .....:....||.....||.||:|:|.::.:|.|::.|
Yeast   131 WFGRGEMQPSFEDAAFQLKVGEVSDIVESGSGVHVIKR 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32845NP_728511.1 WW 73..103 CDD:278809 9/29 (31%)
Rotamase_2 127..237 CDD:298667 40/114 (35%)
ESS1NP_012551.2 WW 10..43 CDD:197736 10/31 (32%)
Rotamase_2 59..170 CDD:421736 40/113 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346100
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0760
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S623
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001686
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10657
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.750

Return to query results.
Submit another query.