DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32845 and pin1

DIOPT Version :9

Sequence 1:NP_728511.1 Gene:CG32845 / 318243 FlyBaseID:FBgn0052845 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_957042.1 Gene:pin1 / 393721 ZFINID:ZDB-GENE-040426-1714 Length:159 Species:Danio rerio


Alignment Length:165 Identity:69/165 - (41%)
Similarity:93/165 - (56%) Gaps:12/165 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 KLPFGWEERIAHSTKECYFYDTITRKVHFTLPPSHHREKDRNAWGAILGDYSDFNDQLRCRHILV 136
            |||.|||:|::.|:...|:::      |.|......|.....|.||  ||.    :::||.|:||
Zfish     6 KLPSGWEKRMSRSSGRVYYFN------HITNASQWERPSGSGADGA--GDV----EKVRCSHLLV 58

  Fly   137 KHSESDRCSSYRERMVRRTKQEALNKIMHARDLIQSGKFEFAELANMISDCCSARHGGDLGPLSL 201
            |||:|.|.||:||..:.|:|.|||..|....:.|:||:.||..||:..|||.|||:|||||....
Zfish    59 KHSQSRRPSSWREENITRSKDEALQLIQKYIEQIKSGEEEFESLASQFSDCSSARNGGDLGLFGR 123

  Fly   202 TQTPFVFERNILLLKDGELSEIFQTKAGYHILLRT 236
            .|....||.....||.|::|....|.:|.||:|||
Zfish   124 GQMQKPFEDASFALKVGDMSGPVFTDSGVHIILRT 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32845NP_728511.1 WW 73..103 CDD:278809 10/29 (34%)
Rotamase_2 127..237 CDD:298667 52/110 (47%)
pin1NP_957042.1 WW 7..37 CDD:278809 10/35 (29%)
PTZ00356 49..159 CDD:185573 52/110 (47%)
SurA <49..155 CDD:223831 48/105 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594798
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437969at2759
OrthoFinder 1 1.000 - - FOG0001686
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10657
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.