DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32845 and Pin1

DIOPT Version :9

Sequence 1:NP_728511.1 Gene:CG32845 / 318243 FlyBaseID:FBgn0052845 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001100171.1 Gene:Pin1 / 298696 RGDID:1310299 Length:165 Species:Rattus norvegicus


Alignment Length:170 Identity:66/170 - (38%)
Similarity:95/170 - (55%) Gaps:16/170 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 KLPFGWEERIAHSTKECYFYDTITRKVHFTLPPSHHREKDRNAWGAILGDYSDFNDQ-----LRC 131
            |||.|||:|::.|:...|:::.||....:          :|.:.|:.:|..|. |.|     :||
  Rat     6 KLPSGWEKRMSRSSGRVYYFNHITNASQW----------ERPSGGSTVGGGSK-NGQGEPARVRC 59

  Fly   132 RHILVKHSESDRCSSYRERMVRRTKQEALNKIMHARDLIQSGKFEFAELANMISDCCSARHGGDL 196
            .|:|||||:|.|.||:|:..:.|:|:|||..|......|:||:.:|..||:..|||.||:..|||
  Rat    60 SHLLVKHSQSRRPSSWRQEKITRSKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDL 124

  Fly   197 GPLSLTQTPFVFERNILLLKDGELSEIFQTKAGYHILLRT 236
            |..|..|....||.....|:.||:|....|.:|.||:|||
  Rat   125 GAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRT 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32845NP_728511.1 WW 73..103 CDD:278809 10/29 (34%)
Rotamase_2 127..237 CDD:298667 50/115 (43%)
Pin1NP_001100171.1 WW 7..37 CDD:395320 10/39 (26%)
Rotamase_2 53..164 CDD:421736 47/110 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352845
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0760
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437969at2759
OrthoFinder 1 1.000 - - FOG0001686
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10657
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.