DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32845 and pin1

DIOPT Version :9

Sequence 1:NP_728511.1 Gene:CG32845 / 318243 FlyBaseID:FBgn0052845 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_587913.1 Gene:pin1 / 2539218 PomBaseID:SPCC16C4.03 Length:175 Species:Schizosaccharomyces pombe


Alignment Length:174 Identity:59/174 - (33%)
Similarity:88/174 - (50%) Gaps:17/174 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LPFGWEERIAHSTKECYFYDTITRKVHFTL--PPSHHREKDRNAWGAILGD---------YSDFN 126
            ||..|..:|:.|....||::|.|   |.:|  ||:   ..|..|....:.:         .:..:
pombe     6 LPKPWIVKISRSRNRPYFFNTET---HESLWEPPA---ATDMAALKKFIANELQESVTPTEASNS 64

  Fly   127 DQLRCRHILVKHSESDRCSSYRERMVRRTKQEALNKIMHARDLIQSGKFEFAELANMISDCCSAR 191
            .::|..|:||||.||.|.||::|..:.|:|:||.....|...|::||.....:||...|||.|||
pombe    65 PKIRASHLLVKHRESRRPSSWKEEHITRSKEEARKLAEHYEQLLKSGSVSMHDLAMKESDCSSAR 129

  Fly   192 HGGDLGPLSLTQTPFVFERNILLLKDGELSEIFQTKAGYHILLR 235
            .||:||.....:....||.....||.||:|.:.:|.:|:||:.|
pombe   130 RGGELGEFGRDEMQKPFEDAAFALKPGEISGVVETSSGFHIIQR 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32845NP_728511.1 WW 73..103 CDD:278809 11/31 (35%)
Rotamase_2 127..237 CDD:298667 44/109 (40%)
pin1NP_587913.1 WW 5..37 CDD:197736 12/33 (36%)
SurA <7..172 CDD:223831 57/170 (34%)
Rotamase_2 63..175 CDD:298667 44/111 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0760
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001686
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10657
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.