DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32845 and pinn-1

DIOPT Version :9

Sequence 1:NP_728511.1 Gene:CG32845 / 318243 FlyBaseID:FBgn0052845 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_494393.2 Gene:pinn-1 / 190941 WormBaseID:WBGene00022448 Length:161 Species:Caenorhabditis elegans


Alignment Length:168 Identity:59/168 - (35%)
Similarity:89/168 - (52%) Gaps:15/168 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 NKLPFGWEERIAHSTKECYFYDTITRKVHFTLPPSHHREKDRNAWGAILGDYSDFNDQLRCRHIL 135
            |.||.|||:|.:.|....|:::|.|.:..:..|       |.:|:    |..|:.. .::|.|:|
 Worm     4 NSLPAGWEKRQSRSNDRVYYFNTATGRSQWERP-------DESAF----GKGSELK-SVQCLHLL 56

  Fly   136 VKHSESDRCSSYRERMVRRTKQEALNKIM-HARDLIQSGKFE--FAELANMISDCCSARHGGDLG 197
            |||..|...||:|...:.|:|.:|:|.:. :.::|..:...|  |.|||...|||.||:.|||||
 Worm    57 VKHDGSRNPSSWRSDHITRSKDDAINILKNYEKELKDASNIEGKFRELAKQFSDCSSAKRGGDLG 121

  Fly   198 PLSLTQTPFVFERNILLLKDGELSEIFQTKAGYHILLR 235
            |....|....||.....|:.||:|:|..|.:|.|::.|
 Worm   122 PFERRQMQKPFEDASFALEIGEMSDIVDTSSGVHLIYR 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32845NP_728511.1 WW 73..103 CDD:278809 10/29 (34%)
Rotamase_2 127..237 CDD:298667 43/112 (38%)
pinn-1NP_494393.2 WW 6..36 CDD:278809 10/29 (34%)
SurA <43..161 CDD:223831 44/118 (37%)
PTZ00356 46..161 CDD:185573 43/115 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166370
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0760
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S623
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437969at2759
OrthoFinder 1 1.000 - - FOG0001686
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10657
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.760

Return to query results.
Submit another query.