DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and YDL114W

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_010169.1 Gene:YDL114W / 851444 SGDID:S000002272 Length:308 Species:Saccharomyces cerevisiae


Alignment Length:255 Identity:67/255 - (26%)
Similarity:119/255 - (46%) Gaps:42/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLR-QSLPAEQRMRFHQ---HKCDV 65
            :|..|:|:|.|||:|...|:          .|:||.:::.... ||.|...::.::.   ::||:
Yeast    37 KNATALITGGSSGLGFELAK----------ELSRRINKVIVADIQSFPTFAQVEYNNIFYYQCDI 91

  Fly    66 SQELQVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAASSM 130
            :...::....:.||::.|.|:::|||||:....:|..|..|::..::..||:|:.......|..|
Yeast    92 TSLDEIKNLKKAIERDHGNINIIINNAGVAHIKKLEHMTNKEVEQLIDINLIGAYRIISTFAEDM 156

  Fly   131 RRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICR----QELINQGSK--IK 189
                :.....|:.:.|.|.| :..||  .|.:|..||.|:....: |.    :.|..:.:|  ||
Yeast   157 ----IDNREGFIINIASVLG-ELTPA--RLTSYGASKGAMIGFHK-CMSRHFRSLSTECNKTGIK 213

  Fly   190 TTSINPGWVATEI---VPDETKAKLGEVILQADDV--AQAVLYALSTPPHTQVEQITLRA 244
            |..:.||.:.|.:   ||..:|       |.|.|:  :|..|..:|...|..::  ||.|
Yeast   214 TLLVCPGKIKTNMFIDVPTPSK-------LLAPDIIPSQLALAIISAMEHNHLQ--TLNA 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 67/255 (26%)
NADB_Rossmann 1..243 CDD:304358 65/252 (26%)
YDL114WNP_010169.1 17beta-HSDXI-like_SDR_c 40..282 CDD:187598 66/252 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.