DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and NOL

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_568145.1 Gene:NOL / 830372 AraportID:AT5G04900 Length:348 Species:Arabidopsis thaliana


Alignment Length:245 Identity:68/245 - (27%)
Similarity:116/245 - (47%) Gaps:28/245 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSLPAEQRMRFHQH----KCDVSQELQ 70
            :|:|::.|||.|.||..:.||..||..:|..:|:|...|||..|    |.:|    ||||::...
plant    83 LITGSTKGIGYALAREFLKAGDNVVICSRSAERVETAVQSLKEE----FGEHVWGTKCDVTEGKD 143

  Fly    71 VDTAFEWIEKELGGIDVLINNAG--IVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAASSMRRR 133
            |.....:.:|.|..||:.|||||  ......|.:...:|:..:::||.:|.:.|.:.|.:.|..:
plant   144 VRELVAYSQKNLKYIDIWINNAGSNAYSFKPLAEASDEDLIEVVKTNTLGLMLCCREAMNMMLTQ 208

  Fly   134 QVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSK-IKTTSINPGW 197
            ...||:..::. ||..| :|.|   ...||..:|.::..:.:..:.||..|..| :...:::||.
plant   209 SRGGHIFNIDG-AGSDG-RPTP---RFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGM 268

  Fly   198 VATEIVPDETKAKLGEVILQADDVAQAVLYALSTPPHTQVEQI--TLRAV 245
            |.|:::......|          .|:..:..|:.|.....|.:  .:||:
plant   269 VTTDLLMSGATTK----------QAKFFINVLAEPAEVVAEYLVPNIRAI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 68/245 (28%)
NADB_Rossmann 1..243 CDD:304358 66/241 (27%)
NOLNP_568145.1 adh_short 81..276 CDD:278532 61/201 (30%)
SDR_c 82..302 CDD:212491 66/237 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2312
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - mtm1174
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.930

Return to query results.
Submit another query.