DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and NYC1

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_567400.1 Gene:NYC1 / 826942 AraportID:AT4G13250 Length:496 Species:Arabidopsis thaliana


Alignment Length:288 Identity:84/288 - (29%)
Similarity:123/288 - (42%) Gaps:63/288 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLE----QLRQSL-------PAEQRMRFHQ 60
            |..||:|::.|:|.|.||..:.:|.:|:..:|.::.::    :|.|:|       ....|.:...
plant   162 RNVVITGSTRGLGKALAREFLLSGDRVIVTSRSSESVDMTVKELEQNLKEIMSNASESARKKLSD 226

  Fly    61 HK-----CDVSQELQVDTAFEWIEKELGGIDVLINNAGIVLGGQ-LIDMPTKDINNILQTNLMGS 119
            .|     |||.:...|:....:..||||.|::.|||||...|.: |::...:||..|:.|||:||
plant   227 AKVVGIACDVCKPEDVEKLSNFAVKELGSINIWINNAGTNKGFRPLLEFTEEDITQIVSTNLIGS 291

  Fly   120 IYCTKLAASSMRRRQVAGHLIFVNSTAGVAGYKPDPADESLNA-YTPSKFAL------------- 170
            |.||:.|...|.|:...|| ||....||..|     :...|.| |..:|..|             
plant   292 ILCTRGAMDVMSRQHSGGH-IFNMDGAGSGG-----SSTPLTAVYGSTKCGLRQFHGSIVKESQK 350

  Fly   171 ------TAVQEICRQELINQGSKIKTTSI------NPGWVATEIVPDETKAKLGEVILQADDVAQ 223
                  ||...:...||:..||.||...:      .|..||..:||.....|         ...:
plant   351 TNVGLHTASPGMVLTELLLSGSSIKNKQMFNIICELPETVARTLVPRMRVVK---------GSGK 406

  Fly   224 AVLYALSTPPHTQVEQIT--LRAVGEYF 249
            ||.|.  |||...:..:|  ||. |.:|
plant   407 AVNYL--TPPRILLAIVTSWLRR-GRWF 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 83/286 (29%)
NADB_Rossmann 1..243 CDD:304358 80/280 (29%)
NYC1NP_567400.1 SDR_c 164..395 CDD:212491 69/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - mtm1174
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.