DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and dhrs7

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001038811.1 Gene:dhrs7 / 751626 ZFINID:ZDB-GENE-060825-21 Length:338 Species:Danio rerio


Alignment Length:228 Identity:67/228 - (29%)
Similarity:101/228 - (44%) Gaps:27/228 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WQNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQL------RQSLPAEQRMRFHQHK 62
            ::.:|..|:|||||||...:..|.|.|.::|..|||.:.||::      |.||.||..:......
Zfish    47 FRGKVVWITGASSGIGEELSLQLAAIGARLVLSARRENELERVKRLCLERSSLKAEDILVLPLDL 111

  Fly    63 CDVSQELQVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAA 127
            .|.:...:..||   ..:..|.|||||||.|.......:|........:::.|.:|::..||   
Zfish   112 MDRASHPEKTTA---ALEHFGEIDVLINNGGRSQRALCVDADVDVYQALMELNYLGTVSITK--- 170

  Fly   128 SSMRRRQVAGHLI-----FVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSK 187
                  ||..|:|     .:.:.:.|||:...|.   ...|..||.||.......|.|| :....
Zfish   171 ------QVLPHMIQRGTGIIATVSSVAGFVGVPL---ATGYAASKHALQGFFNSLRTEL-SDCPN 225

  Fly   188 IKTTSINPGWVATEIVPDETKAKLGEVILQADD 220
            |..::|.||.|.:.||.:....:||:.:..|.|
Zfish   226 ILISNICPGPVISSIVQNAFTEELGKPVATAGD 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 67/228 (29%)
NADB_Rossmann 1..243 CDD:304358 67/228 (29%)
dhrs7NP_001038811.1 11beta-HSD1_like_SDR_c 47..307 CDD:187593 67/228 (29%)
adh_short 50..249 CDD:278532 63/214 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.