DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and Dhrs2

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_082066.2 Gene:Dhrs2 / 71412 MGIID:1918662 Length:282 Species:Mus musculus


Alignment Length:227 Identity:68/227 - (29%)
Similarity:105/227 - (46%) Gaps:35/227 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQ----LRQSLPAEQRMRFHQHKCDVSQ 67
            :||||:|::.|||.|.||.|...|..||..:|:.:.:::    |::...:......|..|.:..|
Mouse    38 KVAVITGSTRGIGFAIARRLAQDGAHVVISSRKQENVDEAVTILKEEGLSVTGTMCHVGKAEDRQ 102

  Fly    68 ELQVDTAFEWIEKELGGIDVLINNAGI-VLGGQLIDMPTKDINNILQTNLMG-SIYCTKLAASSM 130
            .| |.||.    |..||||.|:..||: .|.|..:....:..:.||..|:.. ::..:|:.....
Mouse   103 HL-VTTAL----KHSGGIDFLVCVAGVNPLVGSTLGASEQIWDKILDVNVKSPALLLSKVLPYME 162

  Fly   131 RRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSKIKTTSINP 195
            .||  .|.::.|:|  ||| |.|.|   .|..|..||.||..:.:....||..:|  |:...:.|
Mouse   163 NRR--GGSVVLVSS--GVA-YVPVP---KLGVYNTSKTALLGLCKSLAVELAPKG--IRVNCLVP 217

  Fly   196 GWVATE----------IVPDETK----AKLGE 213
            |.:.|:          ::||..|    .:|||
Mouse   218 GIIKTDFSLREKTMPNMLPDMNKIFGVKRLGE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 68/227 (30%)
NADB_Rossmann 1..243 CDD:304358 68/227 (30%)
Dhrs2NP_082066.2 NADB_Rossmann 35..277 CDD:389744 68/227 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.