Sequence 1: | NP_788887.1 | Gene: | CG10962 / 31824 | FlyBaseID: | FBgn0030073 | Length: | 249 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_082066.2 | Gene: | Dhrs2 / 71412 | MGIID: | 1918662 | Length: | 282 | Species: | Mus musculus |
Alignment Length: | 227 | Identity: | 68/227 - (29%) |
---|---|---|---|
Similarity: | 105/227 - (46%) | Gaps: | 35/227 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 RVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQ----LRQSLPAEQRMRFHQHKCDVSQ 67
Fly 68 ELQVDTAFEWIEKELGGIDVLINNAGI-VLGGQLIDMPTKDINNILQTNLMG-SIYCTKLAASSM 130
Fly 131 RRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSKIKTTSINP 195
Fly 196 GWVATE----------IVPDETK----AKLGE 213 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10962 | NP_788887.1 | YdfG | 1..249 | CDD:226674 | 68/227 (30%) |
NADB_Rossmann | 1..243 | CDD:304358 | 68/227 (30%) | ||
Dhrs2 | NP_082066.2 | NADB_Rossmann | 35..277 | CDD:389744 | 68/227 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |