DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and Kdsr

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_081810.1 Gene:Kdsr / 70750 MGIID:1918000 Length:332 Species:Mus musculus


Alignment Length:247 Identity:64/247 - (25%)
Similarity:110/247 - (44%) Gaps:56/247 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSLPAEQRMRFHQHK--------C--- 63
            |::|.|||||...|......|..:..:||..|:|.|.::.:        .:|.        |   
Mouse    36 VVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKDI--------EKHSINDKQVVLCISV 92

  Fly    64 DVSQEL-QVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAA 127
            ||||:. ||:...:..:::||.:|:|:|.||..:.|:..::.......::..|.:||:|.::...
Mouse    93 DVSQDYNQVENVIKQAQEKLGPVDMLVNCAGTSMSGKFEELEVSSFEKLMSINYLGSVYPSRAVI 157

  Fly   128 SSMRRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQEL----------- 181
            ::|:.|:| |.::||:|.||..|.      ....||:.||||:..:.|..:.|:           
Mouse   158 TTMKERRV-GRIVFVSSQAGQLGL------FGFTAYSSSKFAIRGLAEALQMEVKPYNVYVTVAY 215

  Fly   182 --------INQGSKIK---------TTSI-NPGWVATEIVPDETKAKLGEVI 215
                    :.:.:|.|         ||:| .|..||.:||.|..:......|
Mouse   216 PPDTDTPGLAEENKTKPLETRLISETTAICKPEQVAKQIVKDAIQGNFNSSI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 64/247 (26%)
NADB_Rossmann 1..243 CDD:304358 64/247 (26%)
KdsrNP_081810.1 KDSR-like_SDR_c 32..268 CDD:187643 64/247 (26%)
adh_short 34..232 CDD:278532 53/210 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.930827 Normalized mean entropy S2981
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.