DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and zgc:123284

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001032488.1 Gene:zgc:123284 / 641422 ZFINID:ZDB-GENE-051113-92 Length:256 Species:Danio rerio


Alignment Length:213 Identity:50/213 - (23%)
Similarity:95/213 - (44%) Gaps:25/213 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AVISGASSGIGAACARLLVAAGL-QVVGLARRTDR-----LEQLRQSLPAEQRMRFHQHKCDVSQ 67
            |:::||:.|:|....:.|:.|.. ::....|.||.     |.:|.:..|....:    .|.||:.
Zfish     9 ALVTGANRGLGLEMVKQLLEADCSKIFAACRDTDGPNSEVLRELAKKNPDVVTL----VKLDVAD 69

  Fly    68 ELQVDTAFEWIEKELG--GIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSI--------YC 122
            ...:..:.:.:...||  |:::|:|||.|:....::....:|::|...||::|.:        |.
Zfish    70 PASIKESAKKVGSLLGEKGLNLLVNNAAILPQKTMLTCSVEDMHNTFNTNVIGPLFVIREYLPYL 134

  Fly   123 TKLAASSMRRRQVAGHLIFVNSTAGVAGYKPDPADES---LNAYTPSKFALTAVQEICRQELINQ 184
            .....:|.:.....|....:|.:...|.....|:.:.   |..|:.||.||..:.....::|  :
Zfish   135 RAAVKASGKPGMSPGKAAVINISTDAASLSMIPSMKEPFPLFPYSISKVALNMLTVYTARDL--K 197

  Fly   185 GSKIKTTSINPGWVATEI 202
            ..:|...||:||||.|::
Zfish   198 ADEILCISIHPGWVRTDM 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 50/213 (23%)
NADB_Rossmann 1..243 CDD:304358 50/213 (23%)
zgc:123284NP_001032488.1 adh_short 8..215 CDD:278532 50/211 (24%)
carb_red_sniffer_like_SDR_c 9..256 CDD:187586 50/213 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.