DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and si:dkey-12e7.4

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001137514.1 Gene:si:dkey-12e7.4 / 558132 ZFINID:ZDB-GENE-050419-83 Length:256 Species:Danio rerio


Alignment Length:250 Identity:69/250 - (27%)
Similarity:108/250 - (43%) Gaps:32/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VISGASSGIGAACARLLVAAGL---QVVGLARRTDRLEQLRQSLPAEQRMRFHQHKCDVSQELQV 71
            :|:|||.|:|......||..|.   :::..||..:..::|::.  ||:....|..|.||..:..:
Zfish    12 MITGASRGLGLQIVESLVTGGFSPGKIIATARNPNGAKELQRL--AEEYQNIHIIKLDVISQESI 74

  Fly    72 DTAF----EWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAASSMRR 132
            :.|.    |.:::|  |::.|||||||.:...|..:....:.....||.:..:..||.....::|
Zfish    75 ERAAAEVEELVQEE--GLNCLINNAGINVVANLETVTADQMLENFHTNSVAPLMITKAMLPLLKR 137

  Fly   133 RQVAG-----H---LIFVNSTAG-VAGYKPDPADE-SLNAYTPSKFALTAVQEICRQELINQGSK 187
            ....|     |   :|.|.|..| |..|..|.||. ....|..||.||..|......:|...|  
Zfish   138 AAAKGTGMGIHRAAVINVTSLLGSVELYWGDRADTFKWYPYRTSKSALNMVTRCLAVDLEADG-- 200

  Fly   188 IKTTSINPGWVATE-------IVPDETKAKLGEVI--LQADDVAQAVLYALSTPP 233
            |...:::||||.|:       :.|:|:.:.:..||  |...|....:.|...|.|
Zfish   201 ILCMALHPGWVRTDMGGPEAPLSPEESISSVLSVIGGLTEKDHGSFLHYTGETLP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 68/249 (27%)
NADB_Rossmann 1..243 CDD:304358 68/249 (27%)
si:dkey-12e7.4NP_001137514.1 carb_red_sniffer_like_SDR_c 12..256 CDD:187586 68/249 (27%)
adh_short 13..218 CDD:278532 60/210 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.