DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and dhrs7cb

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001018493.1 Gene:dhrs7cb / 553684 ZFINID:ZDB-GENE-050522-226 Length:324 Species:Danio rerio


Alignment Length:230 Identity:64/230 - (27%)
Similarity:90/230 - (39%) Gaps:44/230 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSLPAEQRMRFHQHKCDVSQEL 69
            :|:|.||:.|.||:|:.||||..|.|.::|......|:||.|..||            |..|...
Zfish    36 RNKVVVITDAVSGMGSECARLFHAGGARLVLCGPSWDKLESLYDSL------------CSGSDPS 88

  Fly    70 QVDT----AFEWIEKE------------LGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMG 118
            |..|    ..::.:.|            .|.:||||.|:.:.:...:.::..:....|:..|..|
Zfish    89 QTFTPKLVLLDFSDMENISDVVSEICECYGCVDVLICNSSMKVKAPVQNLSLEMDKTIMDVNYFG 153

  Fly   119 SIYCTKLAASSMRRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELIN 183
            .|...|.....|..|: .|..:.|||..|..      |......|..||.|:.|..:..|.|:..
Zfish   154 PITLAKGVLPLMITRR-TGQFVLVNSIQGKL------ALPFRTCYAASKHAVQAFFDCLRAEVEE 211

  Fly   184 QGSKIKT---TSINPG------WVATEIVPDETKA 209
            .|..:.|   |.||.|      ..||.|....|||
Zfish   212 FGISVSTISHTFINAGAENATPTEATPITATPTKA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 64/230 (28%)
NADB_Rossmann 1..243 CDD:304358 64/230 (28%)
dhrs7cbNP_001018493.1 11beta-HSD1_like_SDR_c 35..309 CDD:187593 64/230 (28%)
adh_short 38..219 CDD:278532 52/199 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.