DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and dhrs7b

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_021326304.1 Gene:dhrs7b / 550454 ZFINID:ZDB-GENE-050417-277 Length:316 Species:Danio rerio


Alignment Length:241 Identity:72/241 - (29%)
Similarity:119/241 - (49%) Gaps:31/241 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSLPAEQRMRFHQH-KCDVSQE 68
            |::|.||:|||||:|..|||:..|||.:::...|...||:::.:.|..:...:...: .|.|:.:
Zfish    43 QDKVVVITGASSGLGKECARVFHAAGARLILCGRDQRRLQEVVEELRNKTYGKTQTYTPCTVTFD 107

  Fly    69 LQ----VDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAASS 129
            |.    |.:|...|.|..|.|||||||||:...|.::|........:::||..|.:..|:....|
Zfish   108 LSNTSVVCSAAAEILKCHGHIDVLINNAGVSYRGNILDTHVSVQREVMETNYFGPVALTQAILPS 172

  Fly   130 MRRRQVAGHLIFVNSTAGVAG--YKPDPADESLNAYTPSKFALTAVQEICRQELINQGSKIKTTS 192
            |..|. :||::.::|..|...  |:        :||..||.|:.|..:..|.|:.:.|  :..:.
Zfish   173 MVDRG-SGHIVVISSVQGKISIPYR--------SAYAASKHAMQAYYDCLRAEVDSLG--LHVSV 226

  Fly   193 INPGWVATEI-------------VPDETKAKLGEVILQADDVAQAV 225
            ::||:|.|.:             |.|.|.|...:.:..|.|:.:||
Zfish   227 LSPGYVRTNMSINAVTGDGSKYGVMDRTTATGADPVDVAKDILKAV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 72/241 (30%)
NADB_Rossmann 1..243 CDD:304358 72/241 (30%)
dhrs7bXP_021326304.1 11beta-HSD1_like_SDR_c 42..303 CDD:187593 72/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.