DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and HSD17B11

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_057329.3 Gene:HSD17B11 / 51170 HGNCID:22960 Length:300 Species:Homo sapiens


Alignment Length:232 Identity:57/232 - (24%)
Similarity:99/232 - (42%) Gaps:25/232 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VAVISGASSGIG-------AACARLLVAAGLQVVGLARRTDRLEQLRQSLPAEQRMRFHQHKCDV 65
            :.:|:||..|||       |.....||...:...||.....:.:.|        ..:.|....|.
Human    38 IVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGL--------GAKVHTFVVDC 94

  Fly    66 SQELQVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAASSM 130
            |....:.::.:.::.|:|.:.:|:||||:|....|.......|....:.|::...:.||....:|
Human    95 SNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAM 159

  Fly   131 RRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELIN-QGSKIKTTSIN 194
            .:.. .||::.|   |..||:...|   .|.||..||||.....:....||.. |.:.:|||.:.
Human   160 TKNN-HGHIVTV---ASAAGHVSVP---FLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLC 217

  Fly   195 PGWVATEIVPDETKAKLGEVILQADDVAQAVLYALST 231
            |.:|.|..:.:.: ..||.. |:.::|...:::.:.|
Human   218 PNFVNTGFIKNPS-TSLGPT-LEPEEVVNRLMHGILT 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 57/232 (25%)
NADB_Rossmann 1..243 CDD:304358 57/232 (25%)
HSD17B11NP_057329.3 17beta-HSDXI-like_SDR_c 38..277 CDD:187598 57/232 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.