DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and CG5590

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster


Alignment Length:267 Identity:65/267 - (24%)
Similarity:113/267 - (42%) Gaps:56/267 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSL--PAE--QRMRFHQHKC--DV 65
            |...|:|||.|||...|......|..:|..|:..:...:|..::  .||  ::.....:.|  ||
  Fly    10 RTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGGKAYPCVVDV 74

  Fly    66 SQELQVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKD------INNILQTNLMGSIYCTK 124
            ..|.||.:|.|....:.||||::||||..:   .|.:.|..|      ::||   |..|:...:|
  Fly    75 RDEQQVRSAVEAAVAKFGGIDIVINNASAI---SLTNTPDTDMKRYDLMHNI---NTRGTFLVSK 133

  Fly   125 LAASSMRRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSKIK 189
            :....:::...| |::.::....:   ||......: |||.:|:.::    :|   ::...::.|
  Fly   134 VCLPYLKKSNHA-HILNISPPLSM---KPKWFGPHV-AYTMAKYGMS----MC---VLGMAAEFK 186

  Fly   190 T--TSINPGWVATEI---------VPDETK-AKLGEVILQADDVAQAVLYALSTPPHTQVEQITL 242
            .  .|:|..|..|.|         .||..| ::..|::..|       .||:.|....|      
  Fly   187 DEGISVNALWPRTAIHTAAIEMLTGPDSAKWSRKPEIMADA-------AYAILTREPRQ------ 238

  Fly   243 RAVGEYF 249
             :.|::|
  Fly   239 -STGQFF 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 64/265 (24%)
NADB_Rossmann 1..243 CDD:304358 63/259 (24%)
CG5590NP_651578.1 FabG 5..245 CDD:223959 65/267 (24%)
PRK08278 7..277 CDD:181349 65/267 (24%)
SCP2 317..406 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435152
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.