DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and CG10425

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_651363.1 Gene:CG10425 / 43043 FlyBaseID:FBgn0039304 Length:336 Species:Drosophila melanogaster


Alignment Length:299 Identity:74/299 - (24%)
Similarity:111/299 - (37%) Gaps:76/299 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRL-------EQLRQSLPAEQRMRFHQHKCD 64
            |..|::|.|.|||...|......|..|..:||....|       |.:||    ....:|.....|
  Fly    36 RHVVVTGGSKGIGLCLAVECAMKGANVTVIARDEKMLSGAVALMEVIRQ----RPDQKFQYRSLD 96

  Fly    65 VSQEL-QVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAAS 128
            :|.:. ||......||...|.|..|||.||:.:.|...::..:|::.::..|..|:..||:....
  Fly    97 ISGDYDQVAKVLGEIEDSFGPIYTLINCAGMAICGVFEEVSVQDVHKLMNVNFFGTYNCTRYVLP 161

  Fly   129 SMRRRQVAGHLIFVNSTA-----GVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQG--- 185
            .|::   ||..|.|.:.:     |:.||.|         |:.:|:||.|:.|....|....|   
  Fly   162 KMKK---AGDGIIVITASQAAMFGIYGYGP---------YSATKYALRAMAETIAMESREHGVSV 214

  Fly   186 ------------------SKIKTTS--------INPGWVATEIVPDETKAK-------------- 210
                              ||.:.|.        |.|..:|..|:.|..|.|              
  Fly   215 TLAMPCDTNTPGFEEEEKSKPRETKIISGGGGLIEPEVMAKAILKDALKGKFTSTVGAESWLITT 279

  Fly   211 LGEVILQADDVAQAVLYALSTPPHTQVEQITLRAVGEYF 249
            ||..:|..|.....:|:|:...|    .:|...|:.:||
  Fly   280 LGGALLPWDGFFTNLLHAIVLGP----LRIVSYALHKYF 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 72/297 (24%)
NADB_Rossmann 1..243 CDD:304358 71/291 (24%)
CG10425NP_651363.1 KDSR-like_SDR_c 35..271 CDD:187643 63/250 (25%)
adh_short 36..229 CDD:278532 53/208 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.930827 Normalized mean entropy S2981
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.