DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and CG13833

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster


Alignment Length:230 Identity:56/230 - (24%)
Similarity:107/230 - (46%) Gaps:24/230 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VAVISGASSGIGAACARLLVAAGLQV----VGLARRTDRLEQLRQSLPAEQRMRFHQHKCDVSQE 68
            |||::||..|:|.|.:..|...|..:    :.::...|.::|::..    .::|...:|.:|:..
  Fly    54 VAVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAEDTVKQIQDI----YKVRAKAYKANVTNY 114

  Fly    69 LQVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAASSMRRR 133
            ..:......:.:|:|.:.||:||||:::...:.:....|:..::..||. |.:.|||......:.
  Fly   115 DDLVELNSKVVEEMGPVTVLVNNAGVMMHRNMFNPDPADVQLMINVNLT-SHFWTKLVFLPKMKE 178

  Fly   134 QVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSK-IKTTSINPGW 197
            ...|.::.::|.|||.   |.|...:   ||.:|....|.....|.||..:..| |..|::.|.:
  Fly   179 LRKGFIVTISSLAGVF---PLPYSAT---YTTTKSGALAHMRTLRMELDLENQKDIHVTTVLPSF 237

  Fly   198 VATEIVPDETKAK----LGEV--ILQADDVAQAVL 226
            :.|.  .|.|:..    .|:|  :...::|||.::
  Fly   238 LRTN--SDVTQLTHTIGFGDVYPLFTGEEVAQRIV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 56/230 (24%)
NADB_Rossmann 1..243 CDD:304358 56/230 (24%)
CG13833NP_651111.1 adh_short 53..241 CDD:278532 48/197 (24%)
NADB_Rossmann 54..297 CDD:304358 56/230 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.