DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and rdh8b

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_957082.2 Gene:rdh8b / 393761 ZFINID:ZDB-GENE-040426-1759 Length:317 Species:Danio rerio


Alignment Length:234 Identity:62/234 - (26%)
Similarity:98/234 - (41%) Gaps:53/234 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSLPAEQRMRFHQHK--------- 62
            :|.:|:|.|||||              :|:|....|.:|.|..:.|..|....|.|         
Zfish     7 KVVLITGCSSGIG--------------LGIAVMLARDKQQRYYVIATMRDLKRQDKLVCAAGDTY 57

  Fly    63 ------C--DVSQELQVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGS 119
                  |  ||.....|....:.::..  .||:||||||:.|.|.:..:...|:..:.:||..|:
Zfish    58 GKTLTVCTLDVCSNESVRQCVDSVKDR--HIDILINNAGVGLVGPVEGLSLDDMMKVFETNFFGA 120

  Fly   120 IYCTKLAASSMRRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQ 184
            :...|.....|::|: :||:|.::|..|:.|...:      :.|..||||:....|....:|:. 
Zfish   121 VRMIKEVMPDMKKRR-SGHIIVISSVMGLQGVAFN------DVYAASKFAIEGFCESLAVQLLK- 177

  Fly   185 GSKIKTTSINPGWVATEIVPDETKAKLGEVILQADDVAQ 223
             ..:..:.|.||.|.||.   |.|        ..|||::
Zfish   178 -FNVTMSMIEPGPVHTEF---EMK--------MYDDVSK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 62/234 (26%)
NADB_Rossmann 1..243 CDD:304358 62/234 (26%)
rdh8bNP_957082.2 type1_17beta-HSD-like_SDR_c 7..264 CDD:187666 62/234 (26%)
adh_short 7..202 CDD:278532 60/230 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.