DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and hsd11b1la

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_956617.2 Gene:hsd11b1la / 393293 ZFINID:ZDB-GENE-040426-1002 Length:287 Species:Danio rerio


Alignment Length:226 Identity:52/226 - (23%)
Similarity:97/226 - (42%) Gaps:16/226 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSLPAEQRMRFHQHKCDVSQELQVDTA 74
            :::|||:|||...|......|.|:|..|||.:.|||:..........:......|::.....|..
Zfish    37 LVTGASTGIGEQLAYHYARLGAQIVITARRGNVLEQVVSKCREMGAQKAFYIPADMANPSDADLV 101

  Fly    75 FEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINN---ILQTNLMGSIYCTKLAASSMRRRQVA 136
            .::..::|||:|.|:.|.   :|.....|...|:.:   :|:.|.:..:...:.|..::.:.:  
Zfish   102 VKYAIEQLGGLDYLVLNH---IGPSPYQMWDGDVQHTRWLLEVNFLSYLQMAQKALPTLEKSK-- 161

  Fly   137 GHLIFVNSTAG-VAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSKIKTTSINPGWVAT 200
            |.::.|:|..| :.|....|       |..:||||.......:.||..|.|.:..|....|.:.|
Zfish   162 GSIVVVSSLLGKICGPFALP-------YASTKFALNGFFGGLQNELAMQKSNVSITICILGLIDT 219

  Fly   201 EIVPDETKAKLGEVILQADDVAQAVLYALST 231
            :...::.|..:......:.:.|..::.|.:|
Zfish   220 DSAMEKIKGYINMTAYPSHEAALQIIQAGAT 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 52/226 (23%)
NADB_Rossmann 1..243 CDD:304358 52/226 (23%)
hsd11b1laNP_956617.2 11beta-HSD1_like_SDR_c 31..278 CDD:187593 52/226 (23%)
adh_short 36..229 CDD:278532 49/203 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.