DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and Y37E11AM.3

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001294377.1 Gene:Y37E11AM.3 / 36805052 WormBaseID:WBGene00021367 Length:347 Species:Caenorhabditis elegans


Alignment Length:236 Identity:74/236 - (31%)
Similarity:113/236 - (47%) Gaps:27/236 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSLPA-----EQRMRFHQHKCDVS 66
            |.|:::|.|.|||...|..|:..|..|..:||....||:....|..     .||.:.|....|::
 Worm    39 RHAIVTGGSKGIGFQLAVGLIERGCHVTIVARNVKDLEKACADLQVLADQRGQRQKVHWKSIDMT 103

  Fly    67 QELQV-DTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAASSM 130
            ....| .:||:...:|||.||:||||||..:.....::|..|....:..|.:.:::.|:.....|
 Worm   104 GGYDVIKSAFDDAARELGPIDILINNAGHSVQAPFCELPITDFEKQMAVNYLSAVHATRAVVDDM 168

  Fly   131 RRRQVAGHLIFVNSTAG---VAGYKPDPADESLNAYTPSKFALTAVQEICRQEL----INQGSKI 188
            :.|: .||:.||:|.||   :.||         :||:|:||||....:....||    :|.|...
 Worm   169 KTRK-TGHISFVSSAAGQFAIFGY---------SAYSPTKFALRGFADTLHMELLPYKVNVGVLY 223

  Fly   189 KTTSINPGW-VATEIVPDETKAKLGEV--ILQADDVAQAVL 226
            ...:...|: |..|.:|:||| |:.|.  :....|||:|.|
 Worm   224 PPNTDTEGFKVELETMPEETK-KMSEAAGLFTPKDVAEAHL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 74/236 (31%)
NADB_Rossmann 1..243 CDD:304358 74/236 (31%)
Y37E11AM.3NP_001294377.1 KDSR-like_SDR_c 39..275 CDD:187643 74/236 (31%)
adh_short 39..240 CDD:278532 63/210 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.