DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and CG2070

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster


Alignment Length:266 Identity:62/266 - (23%)
Similarity:106/266 - (39%) Gaps:40/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQS-LPAEQRMRFHQHKCDVSQELQ 70
            |||:::|.:.|||......|...|..|....|...:.|..|:. :.|.........:.|:.....
  Fly    44 RVAIVTGCNQGIGKETVLELARRGATVYMACRDMKKCENARREIIKATNNQNIFARQLDLCSMKS 108

  Fly    71 VDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMP---TKD-INNILQTNLMGSIYCTKLAASSMR 131
            :.......::|...:.:|||||||      :|.|   |:| ....:..|.||....|.|....: 
  Fly   109 IRNFAAGFKREQNKLHILINNAGI------MDCPKMLTEDGFEMQIGVNHMGHFLLTLLLLDVL- 166

  Fly   132 RRQVAGHLIFVNSTAGVAG-YKPDPADESLN-----AYTPSKFA-LTAVQEICRQELINQGSKIK 189
            :......::.::|.|...| .|.|..:...:     ||..||.| :...:|:.::   ..|:.:.
  Fly   167 KSSAPSRVVVLSSIAHRFGRIKRDDLNSEKSYDRKMAYCQSKLANVLFTRELAKR---LSGTGVT 228

  Fly   190 TTSINPGWVATEIVPDET-------KAKLGEV----ILQADDVAQAVLYALSTPPHTQVEQITLR 243
            ..:::||.|.||:..:..       |..:..:    |..|.:.||..|||...|   .:|:::  
  Fly   229 VNALHPGVVNTELFRNTPFLGSWFGKLLIAPIIWIFIKTARNGAQTTLYAALDP---SLEKVS-- 288

  Fly   244 AVGEYF 249
              |.||
  Fly   289 --GRYF 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 60/264 (23%)
NADB_Rossmann 1..243 CDD:304358 59/258 (23%)
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 62/266 (23%)
NADB_Rossmann 43..317 CDD:304358 62/266 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.