DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and dhs-6

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001021972.1 Gene:dhs-6 / 3565470 WormBaseID:WBGene00000970 Length:418 Species:Caenorhabditis elegans


Alignment Length:284 Identity:68/284 - (23%)
Similarity:101/284 - (35%) Gaps:85/284 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RWQNRVAVISGASSGIGAACARLLVAAGLQVVGLAR--------------RTDRLEQL-RQSLPA 52
            ::..|..:|:|||.|||...|..|...|..:|..|:              ..:.:|:. .::|| 
 Worm     6 KFVGRTVLITGASRGIGKEIALKLAKDGANIVVAAKTATAHPKLPGTIYSAAEEIEKAGGKALP- 69

  Fly    53 EQRMRFHQHKC--DVSQELQVDTAFEWIEKELGGIDVLINNAGIVLGGQLID-----MPTKDINN 110
                      |  ||..|..|..:.|...|:.||||:|||||..:   .|.|     |...|:.:
 Worm    70 ----------CIVDVRDEASVKASVEEAVKKFGGIDILINNASAI---SLTDTENTEMKRYDLMH 121

  Fly   111 ILQTNLMGSIYCTKLAAS-----------------SMRRRQVAGHLIFVNSTAG----VAGYKPD 154
            .:.|.  |:...||....                 .|..|..|.|:.:..:..|    |.|...:
 Worm   122 SINTR--GTFLMTKTCLPYLKSGKNPHVLNISPPLLMETRWFANHVAYTMAKYGMSMCVLGQHEE 184

  Fly   155 --PADESLNAYTPSKFALTAVQEICRQELINQGSKIKTTSINPGWVATEIVPDETKAKLG----- 212
              |...::||..|    |||:.....:.|.::|.:       .|.....|:.|...|.|.     
 Worm   185 FRPHGIAVNALWP----LTAIWTAAMEMLSDKGGE-------AGSRKPSIMADAAYAVLSKNSKD 238

  Fly   213 --------EVILQADDVAQAVLYA 228
                    |.||:|:.|.....||
 Worm   239 FTGNFCIDEDILKAEGVTDFDRYA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 68/284 (24%)
NADB_Rossmann 1..243 CDD:304358 68/284 (24%)
dhs-6NP_001021972.1 PRK08278 9..275 CDD:181349 68/281 (24%)
SCP2 319..411 CDD:376720
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156016
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.