DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and CG9265

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster


Alignment Length:230 Identity:68/230 - (29%)
Similarity:101/230 - (43%) Gaps:24/230 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VAVISGASSGIGAACARLLVAAGLQVV-------GLARRTDRLEQLRQSLPAEQRMRFHQHKCDV 65
            :|:|:|..:|:|...|..|...|.:||       |:|.....:|:.......        :..|:
  Fly    88 IALITGGGNGLGRLLAERLGKMGTKVVIWDINKKGIAETVQIVEEAGGYCKG--------YVVDI 144

  Fly    66 SQELQVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLAASSM 130
            |::.:|..|.:.|..|:|.|.:||||||:|.|..|:|.|...|......|:|...:.||.....|
  Fly   145 SKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLIERSFNVNVMAHFWTTKAFLPKM 209

  Fly   131 RRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQG-SKIKTTSIN 194
            .... .||:..:.|.||..|.      ..|..|..||||.....|..|.||...| :.|:||.|.
  Fly   210 IEND-RGHIATIASLAGHVGI------SKLVDYCASKFAAVGFDEALRLELEVLGHTNIRTTCIC 267

  Fly   195 PGWVATEIVPDETKAKLGEVILQADDVAQAVLYAL 229
            |.::....:.|:..|:.... |..:|||..|:.|:
  Fly   268 PFFIQATGMFDDVNARWVPT-LNPNDVADRVIAAI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 68/230 (30%)
NADB_Rossmann 1..243 CDD:304358 68/230 (30%)
CG9265NP_001260655.1 fabG 82..299 CDD:235546 67/226 (30%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 68/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.