DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and CG9150

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster


Alignment Length:251 Identity:118/251 - (47%)
Similarity:170/251 - (67%) Gaps:2/251 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDRWQNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSLPAEQRMRFHQHKCDV 65
            |:||||::||::|||.||||||||.::.|||:|||||||..:|::||:|||.|.:..|...:|||
  Fly     1 MERWQNKLAVVTGASGGIGAACARAMIGAGLRVVGLARREAKLKELRESLPRELQANFIPRRCDV 65

  Fly    66 SQELQVDTAFEWIEKELGGIDVLINNAGIVLGGQLI-DMPTKDINNILQTNLMGSIYCTKLAASS 129
            |:|.||.::|:|||:||.|.|||:|||||....:|: ...|:.:..::.||:||.|:||:.|.::
  Fly    66 SKEDQVQSSFDWIERELEGADVLLNNAGITRETELVTPSNTQKLKEVIDTNVMGVIWCTREAFNN 130

  Fly   130 MRRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSKIKTTSIN 194
            |:||...||::.:||.||...........|.|.|..:|||:||:.|..|||.....:||:.|.|.
  Fly   131 MKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEFQLHSNKIRVTGIC 195

  Fly   195 PGWVATEIVPDETKAKLGEVI-LQADDVAQAVLYALSTPPHTQVEQITLRAVGEYF 249
            ||.|.|.|.|:|....:.::. |:..::|.||:|||.||||.||.:||::.:||.|
  Fly   196 PGAVNTNIFPEEIHFYVKDMARLEPANIADAVMYALRTPPHVQVHEITIKPMGEMF 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 117/249 (47%)
NADB_Rossmann 1..243 CDD:304358 115/243 (47%)
CG9150NP_608991.2 YdfG 1..251 CDD:226674 117/249 (47%)
NADB_Rossmann 1..247 CDD:304358 115/245 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442633
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2312
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D101130at6960
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - mtm6354
orthoMCL 1 0.900 - - OOG6_100320
Panther 1 1.100 - - P PTHR43115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X367
1211.810

Return to query results.
Submit another query.