DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10962 and CG15629

DIOPT Version :9

Sequence 1:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_608859.1 Gene:CG15629 / 33679 FlyBaseID:FBgn0031630 Length:325 Species:Drosophila melanogaster


Alignment Length:205 Identity:48/205 - (23%)
Similarity:86/205 - (41%) Gaps:28/205 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRL-------EQLRQSLPAEQRMRFHQHK-- 62
            :|.:|:|...|:|    ||:      .:..||...|:       |.::.::....:..:...|  
  Fly    57 QVVLITGGGGGVG----RLI------ALNFARLQARIVIWDINQEAIKTTVDLLAKHGYDNCKGY 111

  Fly    63 -CDVSQELQVDTAFEWIEKELGGIDVLINNAGIVLGGQLIDMPTKDINNILQTNLMGSIYCTKLA 126
             .|:|...|:......:.:|:|.:|:||||||||......::..:.|.|....|::...:..|..
  Fly   112 VVDISDREQIYQRASQVTEEVGPVDILINNAGIVCCKPFWELHDRVIQNTYNINIISHYWTVKAF 176

  Fly   127 ASSMRRRQVAGHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQG-SKIKT 190
            ...|.|.. .||::.|.|..|:.|      ....:.|..:|:|.....|....:|...| .:|:.
  Fly   177 LPHMMRNN-RGHIVTVGSVTGMLG------TYGCSDYAATKYACIGFHESLLTDLKAHGYDQIQM 234

  Fly   191 TSINPGWVAT 200
            :.|.|.::.|
  Fly   235 SLICPYYINT 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10962NP_788887.1 YdfG 1..249 CDD:226674 48/205 (23%)
NADB_Rossmann 1..243 CDD:304358 48/205 (23%)
CG15629NP_608859.1 17beta-HSDXI-like_SDR_c 58..298 CDD:187598 48/204 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.